PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0168s0470.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family WRKY
Protein Properties Length: 179aa    MW: 20467.9 Da    PI: 9.227
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0168s0470.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.16.4e-3299157159
                             ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                    WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                             ldDgy+WrKYGqK+vk s+fprsYYrCts+gC+vkk+v+r+++d+ +v++tYeg Hnh 
  SapurV1A.0168s0470.1.p  99 LDDGYRWRKYGQKTVKCSRFPRSYYRCTSNGCNVKKQVQRNSKDEGIVVTTYEGMHNHA 157
                             59********************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.4E-3384157IPR003657WRKY domain
SuperFamilySSF1182906.41E-2891157IPR003657WRKY domain
PROSITE profilePS5081130.3294159IPR003657WRKY domain
SMARTSM007743.8E-3599158IPR003657WRKY domain
PfamPF031062.3E-25100156IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MSMEKYQIFL PVSGPSSPSV SPSSLSIENP VIYFHGDSEN EVRPESRFQH LDAKNSVSQT  60
SRICKGSELR VKPGKRVGDS DDCRKHRFAF QTRSQVDILD DGYRWRKYGQ KTVKCSRFPR  120
SYYRCTSNGC NVKKQVQRNS KDEGIVVTTY EGMHNHATER SSENFEDILR QIQTCTPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-2789156774Probable WRKY transcription factor 4
2lex_A1e-2789156774Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1796131e-139EF179613.1 (Populus tomentosa x P. bolleana) x P. tomentosa putative WRKY transcription factor 01 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322274.11e-104hypothetical protein POPTR_0015s11130g
SwissprotQ9FYA24e-45WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLB9IFE41e-104B9IFE4_POPTR; Uncharacterized protein
STRINGPOPTR_0015s11130.11e-104(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.15e-46WRKY DNA-binding protein 75